PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G126200.3
Common NameB456_008G126200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARF
Protein Properties Length: 634aa    MW: 70777 Da    PI: 6.6062
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G126200.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B375.27.6e-24123223198
                         EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                         f+k+lt sd++++g +++ +k+a+e+     +++ + +++lt +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF   +
  Gorai.008G126200.3 123 FCKILTASDTSTHGGFSVLRKHATEClppldMNQATPTQELTAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFL--R 211
                         99****************************9555556679************************************************..3 PP

                         SSEE..EEEEE- CS
                  B3  87 rsefelvvkvfr 98 
                          +++el+v+v+r
  Gorai.008G126200.3 212 GDNGELRVGVRR 223
                         489999****98 PP

2Auxin_resp103.62.4e-34249328183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         aaha+ t++ F v+Y+Pr+  s+F++ v+k+++a++++ svGmRfkm+fe+eds+err++Gt+vgv d++p +W++SkWrsLk
  Gorai.008G126200.3 249 AAHAVMTQTLFVVYYKPRT--SQFIIGVSKYLEAINNRSSVGMRFKMRFEGEDSPERRFTGTIVGVGDASP-HWSESKWRSLK 328
                         79****************6..9**********************************************999.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.44E-39113252IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.1E-40116238IPR015300DNA-binding pseudobarrel domain
CDDcd100176.52E-21121223No hitNo description
PROSITE profilePS5086312.111123225IPR003340B3 DNA binding domain
SMARTSM010191.1E-22123225IPR003340B3 DNA binding domain
PfamPF023627.2E-22123223IPR003340B3 DNA binding domain
PfamPF065079.9E-32249328IPR010525Auxin response factor
PfamPF023091.5E-11497597IPR033389AUX/IAA domain
SuperFamilySSF542779.16E-12515594No hitNo description
PROSITE profilePS5174525.71518610IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 634 aa     Download sequence    Send to blast
MAQPEGIPRE TGLGVDDLYP ELWKLCAGPL VEIPHVQERV FYFPQGHIEQ LEASTNQELN  60
YEAPLFNLSS KILCRVLHVQ LLAEQETDEV YAQITLQPEP DQSELTSPDP FPTEVPEREV  120
HSFCKILTAS DTSTHGGFSV LRKHATECLP PLDMNQATPT QELTAKDLHG YEWRFKHIFR  180
GQPRRHLLTT GWSTFVTSKR LVAGDAFVFL RGDNGELRVG VRRLGNQQST MPSSVISSQN  240
MHLGVLATAA HAVMTQTLFV VYYKPRTSQF IIGVSKYLEA INNRSSVGMR FKMRFEGEDS  300
PERRFTGTIV GVGDASPHWS ESKWRSLKIQ WDEPAMIQRP ERVSPWEIEP FSASASINLI  360
QPAVKSKRPR PVYILASDTT TNSTGSAFWC HGSTKSHELA RAGSIAEVQS SESSQVVWPM  420
RQNEADAADA SPVELRTSND VMRDQVEKGK KLEISTGCRL FGFNLTNSNS AVSGTVIAPS  480
HIDENPETFQ SPKQQKQNAS ETSTKEIKAK HGTTSSMRTR TKVQMQGIAV GRAIDLTVLK  540
GYDDLINELE KMFDIEGELR HRTKWSVVFT DNEGDMMLVG DDPWVGFCKM VRKIFIYSVD  600
EVKKINGRCK FQASSLEGEG TVVSLGLEHR SGT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1661235313357Auxin response factor 1
4ldw_A1e-1661235313357Auxin response factor 1
4ldw_B1e-1661235313357Auxin response factor 1
4ldx_A1e-1661235313357Auxin response factor 1
4ldx_B1e-1661235313357Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1366370KRPRP
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012437774.10.0PREDICTED: auxin response factor 18-like isoform X1
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLA0A0D2U2540.0A0A0D2U254_G
STRINGPOPTR_0014s09560.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46530.10.0auxin response factor 11
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]